Example_GalaxyDom

Modeling Unit Information

No Regions
(Length)
Type Sequence
1 1-26
(26)
SEQADV QLYTRASQPELAPEDPEDLEHHHHHH
2 27-50
(24)
signaling peptide MFQKKTYAVFLILLLMMFTAACSG
3 51-380
(330)
modeling unit SKTSAEKKESETEKSSDIAQVKIKDVSYTLPSKYDKSTSDDQLVLKVNVA
VKNTGKDPLNVDSMDFTLYQGDTKMSDTDPEDYSEKLQGSTINADKSVEG
NLFFVVDKGKQYELNYTPESYGDKKPKSVTFKIDGKDKKILATADKLQDS
AKALSAYVDVLLFGKDNADFEKITGANKNEIVNDFNESAKDGYLSASGLS
STYADSKALDNIVNGIKEGLSKNSSIQAKTTSISKDEAIVEATVKPVDAS
SLSDRIEDKVKDYYSKNSSASYEEAVKYALQVYPEEFKKLGPASSEKTVE
VKMKKNDIDQWQLDMDDYRAAELVEAFIKE